Query Sequence
>SMc02173
MLKGISPILSPELLSTLRAMGHGDEIALVDGNYPGLEHARRLIRLDGHPLVPVLDAVLSILPIDDFVPEAIFRATVKQDRDALDPVHRDIIACCRKHEPAQPVVPLLGADFYQRVKAAHAVVQTSEPRLYGNVILRKGVIYP
Hit FamilyNo hits found for this sequence


back to search