Query Sequence
>SMc01051
MEASRDIQRLLDIMAALRDPETGCPWDIVQTFETIRPYTIEEAYEVADAIERHDMDDLCDELGDLLLQVVFHARMAEEAGAFSFGDVVEAITRKMIRRHPHVFARSDADTAEAVKLQWEEIKQAEKADRRQRRLQRGVSQEEHAGHLGSIQRSFPALVEALKLQERAAKVGFDWSEPEPILDKVEEEIGELRQALKDGDLGKVADELGDLIFALVNIGRHVGTDPEMALRGTNTKFRRRFGHIEKELEAGGETLDAASLERMEELWQAAKAIERQLT
Hit FamilyFIG00002974
Hit Family FunctionNucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)


back to search