Query Sequence
>SMc00139
MSGLFAALSAGLAWIGAIIDPLCGPAGIFRWFGSGTLLACGDAGWGDEIAYGFLVTASLAVATLPVGLVIGFFVALAKQSEEKSLRLAGNIYTTIFRGLPELLTLFIVYYGLQILVQQFLATVGYEGAVEINAFVAGMIALGVVFSAYCSEVLLSAFKAIPHGQYEAGDALGLHRGKTMRLIILPQLIRIALPGLGNLWMALLKDTALVSVIGLPDILRQTGIAARVTKHAFEFFGIACVLFLVLAMISSVVFSALERSTKRAEAGR
Hit FamilyFIG00961224
Hit Family FunctionArginine transport system permease protein ArtQ


back to search