Query Sequence
>SMa5011
MAGIAVSTNINSDNAEFLCHADETLLDVLRDRLGLMGAKEGCGTGDCGACSIILDDRLVCSCLVLGAEAEGRRIETVEGMAQGDQLHPLQQKFLEHAALQCGICTPGFLIAAKDLLSKNPDPTEEEIRFGLAGNLCRCTGYDKIVRAVQDAAGVMRGA
Hit FamilyFIG00149566
Hit Family FunctionXanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4)


back to search