Query Sequence
>SMa0259
MTAQDLYRIRDFVPDFDTIAAEFAERSWAVSARADVRADIRYGSGVREVIDLILPERVQAGAPLHVFVHGGYWRSGEKINYRFVAAPVLAAGGIAALVEYDLMPGKRLDVLVDQVRRSVLWLQAHAGDFGADPARLTVSGHSAGAHLASFLAATGPEEAYPPSLPTLQGLLLLSGIYDLSGIPDSFLRHEAEMTPMEAAAWSPLTSSQLPCPLRIIAYGADETAPFQNQAAGLCELLRAQDKSAELLPVPDLNHMSIVLDLADTDGVLGRQLHDLVAQPTR
Hit FamilyFIG01963582
Hit Family FunctionEsterase/lipase


back to search