Query Sequence
>SMa0235
MTDKPQRRLRSQDWFDNPDHIDLTALYLERFMNYGVTPEELRCGKPIIGIAQSGSDLTPCNRVHMDLAKRVRDGIRDAGGIPIEFPTHPIFENCKRPTAALDRNLAYLGLVEILYGYPLDGVVLTTGCDKTTPSALMAASTVDIPAIVLSGGPMLDGWHEGDLVGSGTVIWRMRRKLAAGEIDREEFMQAALDSAPSVGHCNTMGTASTMNAMAEALGMSLTGCGAIPAAYRERGQMAYRTGRRAVELVFEDLKPSDILTREAFLNAIRVNSAIGGSTNAQPHLAAMAKHAGVELYPDDWQVHGFDIPLLANIQPAGAYLGERYHRAGGTPAIMWELLKAGKLDGGCRTVTGRTVAENLEGREPTDREVIRPFDEPLKEKAGFLVLKGNLFDFAIMKMSVVSDDFRKRYLQEPGREGVFEGKAVVFDGSEDYHKRINDPELDIDENTILVIRGAGPLGWPGSAEVVNMQPPDHLLKRGIRSLPTIGDGRQSGTADSPSILNASPESAAGGGLAWLRSGDVIRIDFNLGRCDMLVSDEDIERRKADGIPAVPADATPWQRIYRKSVTQLSDGAVLEGAADFRQIAKNMPRHNH
Hit FamilyFIG00021242
Hit Family FunctionXylonate dehydratase (EC 4.2.1.82)


back to search