Query Sequence
>SM_b21528
MLEGVAKSKPVRPGRIYGAPGDGMSGHISLLTALAFIALWLLVTEMGWIKPLFLPSPLAVWDKFVIALTEGVSNSTLAQHTLASLGRVLGAFLLALVTAVPVGILMGVNRVVRGLFDPIIEFYRPLPPLAYLPLIIIWLGIGEFPKVFLIYLAIFAPMAIAARAGVRSVSTEQIHAAYAMGATRAQVIGHVILKAALPEIFTGMRIGIGVGWTTLVAAEMVAAHRGLGFMVLNAAEYLASDTVIMGIVVIGVFAFAFDLMIRYLEKALIPWKGKV
Hit FamilyFIG00060683
Hit Family FunctionTaurine transport system permease protein TauC


back to search