Query Sequence
>SM_b21184
MEALLVINAGSSSLKFQIFGIATAGLERQVRAKLDGIATQPRLKATAADGTELINRRLDATAVPDLPEALSVARDWLATLRGFDLRAIGHRVVHGGPDYVRPVLIETTVLDRLASYQDLAPLHQPNNLAPIRLAMDIKPDVPQVACFDTAFHRGRTEHTDCYALPRTFYEQGVRRYGFHGISYEYIAGRLREVAPEVARGRVIVAHLGSGASMCALKDGRSVETTMGFTALDGLPMGTRPGQLDPGVVLHLLTDQGMSAQAVSDLLYHRSGLKGLSGISNDMRELLGSDDPRASFAIDHFVHRCALDAGMLAAALGGLDAFVFTAGIGENSAPIRARVSEGLAWLGAELDPAANDAGASVISKAGSRVALHVMPTDEELMIARHTLAIIRAR
Hit FamilyFIG00067248
Hit Family FunctionAcetate kinase (EC 2.7.2.1)


back to search