Query Sequence
>SM_b21182
MEAPLKGIRVLELARILAGPWIGQTLADLGADVIKVESPAGDDTRTWGPPFVTGEDDERLDAAYFHACNRGKRSVVLDFTTAEGQEAVRRLAAQSDVLLENFKVGGLAKYGLDYESLSKVNPRLIYCSVTGFGQDGPYAHRAGYDYIVQGMSGIMDLTGEPDREPQKIGVAFADIFTGLYGVIAVQAALAQRERTGEGQQIDMALLDCMTGVLANQALNFLVSGKAPRRLGNAHPNIAPYQVFPTSDGHLIVAVGNDRQFVKFCELLGRPDLAADARYRTNADRVQHRDSLTPELAAETAKYERDTLLEKLEASGVPGGPINTVADVFADPQIVHRQMRVDTPHTGAAAGTSPGVRTPIRFSGATLALDRGVPRLGEHTAEVLAEIGMNSPKGG
Hit FamilyFIG00450481
Hit Family FunctionL-carnitine dehydratase/bile acid-inducible protein F (EC 2.8.3.16)


back to search