Query Sequence
>SM_b20785
MSAIFEVRNLKRSFGGLAVTNDVSLSMAPGDRVALIGPNGAGKTTFVNLVTGNLKPDAGEVRIGGETVTNVDAIGRVRRGLVRSFQVTRLFQDMTPAEHVALAVLQRDGRAGRMFGNFLAMPGVMAEAGSLLGKLGLRDLAHRPVREIAYGQQRLLEIAVALALKPRVLLLDEPAAGVPQSDTGRIEQALADLPDDLAVLMIEHDMDLVFRFAKRVIVLAAGTVIFDGSPADVTKDPRVREAYLGSYADAGSAA
Hit FamilyFIG01075012
Hit Family FunctionFIG01075013: hypothetical protein


back to search