Query Sequence
>SM_b20753
MDFRLSEEQEAIRTMALDFARDEIAPHAVDWDQQKHFPVETLRAAAALGMAGIYIRDDVGGTGLTRLDAAMIIEALATGCPAIASFVSIHNMCAGMIDRYGTDEQRRRLLPPLLTMDVLASYCLTEPGSGSDAAALKTRAVREGDAYLLTGQKQFISGAGESGLYIVMARTGEEGPKGISAFVVEKDAPGLTFGANEKKMGWHAQPTRAVMLDNVRVSVENRLGAEGEGFRIAMAGLDGGRLSIAAASLGGAQSAFDKALAYVQERRAFGKAIGEFQALQFRLADMATDLEIARTFLWRAACALDAADPEATKLCAMAKRFVTDRCFSVANDALQLHGGYGYLADYGVEKIVRDLRVHQILEGTNEIMRLIVSRAIMGRK
Hit FamilyNo hits found for this sequence


back to search