Query Sequence
>SM_b20712
MKKFFLGTAMAVLMSTAAHAETIGVSMALFDDNFLTVLRSGMQEYAKTLDGVELQVEDAQNDVAKQQSQIQNFIAAGVDAIIVNPVDTDATAAMSKIAADAGIPLVYVNREPVNVDTLPDKQAFVASNEQESGTLQTKEICKMLGGKGKAVVMMGELSNQAARMRTKDIHDVIATDECKGIEIVEEQTANWSRTQGSDLMTNWLSAGLEFDAVISNNDEMAIGAIQALKAAGRSMDSVVIGGIDATQDALAAMAAGDLDVTVFQNAAGQGKGSVDAALKLAKGEPVEKKVYIPFELVTKDNLAQYQTKN
Hit FamilyFIG00008311
Hit Family FunctionInositol transport system sugar-binding protein


back to search