Query Sequence
>SM_b20569
MAEVRSLRRGEVALRDLSKSFQINGRPLSVLRNLNLDIRSGECLAIVGASGSGKTTLLRVLAGLETADAGRVLIDGRPVAGVGRERAVIFQEPRLLPWLTVLGNVAFGLKVRGEDSGRAEQRARHYISLVGLADFQDAYPKQLSGGMAQRVGLARALTVKPEILLLDEPLGALDAMTKLTMQQELERIWREENVTMVLVTHDLEEAIYLADRVLILPKQKDGAPRAIDIDLPRPRDRSGARFVRYRQELLREFGLH
Hit FamilyFIG00061912
Hit Family FunctionAlkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB


back to search