Query Sequence
>SM_b20232
MTTIAQSAARRRHAGRTRLSAKHREWIAGYLFVLPDALGLFIFLGVPMALSLVLSVFEVNGFGGYSFVGARNYLRMWNDPLFWKGARVTALYAAMLVPLLYVCGLGLALLVQRTDRFNAIMRSMFFAPHMVSLVVVALVWQFMVVDKIGVVSRLTAALDIGGISLLGDPNFALITIVLVSVWFLMGFYMLIFLGGLQDIPRQYYEAAMIDGAGAIARFWFITLPLLKPTSFFVIMVSMVAAVAGAQAFDIIYVMTKGGPANATSVLIVYIYQQAFGFGAFGYAAAMASILVVALMIVTAVFFALTRGGRFHHEQ
Hit FamilyNo hits found for this sequence


back to search