Query Sequence
>SM_b20019
MGGFIDIQAPLEQEGTKAVVRNWLRKIGDPVKSGDPLVELETDKVTQEVSAPADGVLAEILMRNGDDATPGAVLGRIGSEAAGAGHAPHYSPAVRHAAEEYGLDPATVTGTGRGGRVTRADMDRAFTARQEGPASVAAEAGDRGAAPKSRRIPHSGMRAAIAEHMLNSVTTAPHVTAVFEADFSAVMRHRDEHGKRLAADGTKLSYTAYVVSACVAAMRAVPEVNSRWHEDALETFDDINIGVGISLGDKGLVVPVIHRAQDLSLAEIAARLQDLTTRARSNALSRADVTGGTFTISNHGASGSLLAAPIIINQPQSAILGVGKLDKRVIVREVDGADTIQIRPMAYVSLTIDHRALDGHQTNAWLTHFVRVIETWPK
Hit FamilyFIG01304883
Hit Family FunctionDihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)


back to search