Query Sequence
>RR42_RS34615
MSNEATQAWPAGYRINPCAAGPAPDIVAAFREMPVAAIGDAMSRNIGTIGLRPYHSRPDTVLCGPAVTVRVRPGDNLMIHKALMMVRPGDVLVIDGGGDITQALVGGLMRTTCVARQLGGLVIDGAVRDVLEWAEDGMPIFARGHTHRGPSKDGPGEVNVPVSCAGMAVMPGDLIVGDADGVIAVPAAEAADLLQRTRAHLRKEAKIRADNAAGTSDPERFDAALRAKGLPV
Hit FamilyFIG00978228
Hit Family FunctionDimethylmenaquinone methyltransferase


back to search