Query Sequence
>RR42_RS26105
MPATRKPTKETPMEKDNHPKPFYRSLYFQVITAIVIGVILGHFYPQAGAAMKPLGDGFIKLIKMIIAPIIFCTVVVGIAGMEDMKKVGKTGGLALLYFEVVSAIALVVGLVIINIAKPGVGMNVDVSTLDTKSIAAYTGPGKMQGTVDFLLHVIPNTVVDAFAQGEILQVLLFAVMFGFALHKFGGRGTLVFDFIEKFSHVLFAIVGYIMKVAPIGAFGAMAFTIGKYGVGSLLQLGQLMATFYATCLFFIFVVLGGIARAHGFSIWKFIKYIKEELLIVLGTSSSESVLPRMMAKLENLGARKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNTEMSLTQQLTLLAVLLLTSKGAAGVTGSGFIVLAATLSAVGHVPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWTGDLDVARMHRRLDNESDAEADEPEAVLDPMVARMPASGTSMTR
Hit FamilyFIG00029322
Hit Family FunctionAerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate


back to search