Query Sequence
>RR42_RS17135
MYQHIKVPAGEKITVNQDFSLNVPDNPIIPFIEGDGTGLDITPVMIKVVDAAVAKAYGGKRKISWMEIYAGEKSTKVYGPDVWLPEETLEVLKDYVVSIKGPLTTPVGGGIRSLNVALRQQLDLYVCLRPVAYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWEAESDQAKKLIAFLQNEMGVKKIRFPDTSGIGVKPVSKQGTKRLVRKAIQYAIDNDKPSVTIVHKGNIMKFTEGGFRDWAYELAQQEFGAELIDGGPWCKFKNPKTGREIVIKDAIADAFLQQILLRPAEYSVIATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEILSAEMMLRHMGWTEAADLIISSMEKSILSKKVTYDFARLLEGATQVSCSGFGQVMIDNM
Hit FamilyFIG00000600
Hit Family FunctionIsocitrate dehydrogenase [NADP] (EC 1.1.1.42)


back to search