Query Sequence
>RR42_RS12215
MSFATTDLCDANEARLADGSLRVLSPVFQHFGKRAAFSGPAATLKVFEDNSLVRETVESPGNGRVLVVDGGGSLRCALVGGNLGVLAEKNGWVGILVNGCVRDSGELAVCDIGVRALALHPQKSQKRNVGEREVTVQMPGAVVRPGNWIYADADGVLVADTRLEG
Hit FamilyFIG00000884
Hit Family FunctionRibonuclease E inhibitor RraA


back to search