Query Sequence
>RR42_RS04000
MTTLDINGKPLQVDVDPSTPLLWALRDSLGMTGTKFGCGMAACGACTVHVNGQATRSCVMPISAAQGARITTIEGVTGDKVGRAVLDAWIKHDVAQCGYCQNGQVMSAVGLLRSKKHPSDADIDQAMAGNLCRCGTYQRIRAAIKDAARALA
Hit FamilyFIG00000941
Hit Family FunctionIsoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)


back to search