Query Sequence
>PfGW456L13_932
MKRFRFSSLMLVLGLLFIYLPMLILVIYSFNASKLVTVWGGWSIKWYVGLLDNSQLMGSVVRSLEIACYTAIAAVALGTLAAFVLTRITRFKGRTLFGGLVTAPLVMPEVITGLSLLLLFVAMAQMIGWPQERGIVTIWIAHTTFCAAYVAVVVSARLRELDLSIEEAAMDLGARPWKVFFLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGSTTLPMEVFSAVRLGVKPEINAVASLILLAVSIVTFLVWFFSRRAEESRRRAIQQAIEEAAADSWKQPDVRRAQAPEAA
Hit FamilyFIG01304252
Hit Family FunctionPutrescine transport system permease protein PotI (TC 3.A.1.11.2)


back to search