Query Sequence
>PfGW456L13_9
MDIDLLSNIFYAMVRCGTPLLLVALGELICEKSGVLNLGQEGMMLFGAVIGFIVAFNTGHLWLGVLLAMLAGMLLSSLFALVALVFNANQVATGLALTIFGVGLSTFVGAAWVGKPLAGFEPVAIPYLSEIPLIGRMLFAQDLLVYLSFALFALVAWVILKSRVGLIIQAVGENPDAASAMGLPVLAVRTLAVLFGGAMAGLAGAYLSLAYTPMWAENMSAGRGWIALALVVFASWRVWRLLLGAYLFGLASILHLVAQGLGLAIPSSLLAMLPYVATIGVLVLLSRDAVRTRLYAPVSLGQPWQAGH
Hit FamilyFIG00791769
Hit Family FunctionNucleoside ABC transporter, permease protein 2


back to search