Query Sequence
>PfGW456L13_845
MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYLAYADALVGTPHLVCYAVKANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGSADKIVFSGVGKTRDDMRRALEVGVHCFNVESTDELERLQVVAAELGVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIADAEDVYVRAAQLPNLEVVGVDCHIGSQLTTLPPFIDALDRLLGLVDRLGDCGIYLRHIDLGGGLGVRYKDEEPPLAADYIKAVRERLDGRDLALVFEPGRFIVANAGVLLTQVEYLKHTEHKDFAIVDAAMNDLIRPALYQAWMDVTAVSPRTSAARAYDIVGPICETGDFLAKDRQLALEEGDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGDQAFEVRRRETVAELYAGESLLPE
Hit FamilyFIG00138250
Hit Family FunctionDiaminopimelate decarboxylase (EC 4.1.1.20)


back to search