Query Sequence
>PfGW456L13_812
MKMRVMVLGSGVIGTTSAYYLARAGFEVVVVDRQPAAAMETSFANAGQVSPGYASPWAAPGVPLKAIKWLLQRHAPLAIKATADIDQYLWMAQMLRNCTASRYAVNKERMVRLSEYSRDCLDELRAETGIAYEGRSLGTTQLFRTQAQLDGAAKDIAVLKESGVPFELLDREGIARVEPALASVTDILAGALRLPNDQTGDCQMFTTKLAEMAANLGVQFRFGQDIQRLDFAGDRINGVWIDGKLETADRYVLALGSYSPQLLKPLGIKAPVYPLKGYSLTVPITNPAMAPTSTILDETYKVAITRFDNRIRVGGMAEIAGFDLSLNPRRRETLEMIVNDLYPQGGNLAEASFWTGLRPTTPDGTPIVGATPFKNLFLNTGHGTLGWTMACGSGRLLADLMAKRKPQISAEGLDISRYGNKTQESAKHVSPAPAHQ
Hit FamilyFIG00054875
Hit Family FunctionD-amino acid dehydrogenase small subunit (EC 1.4.99.1)


back to search