Query Sequence
>PfGW456L13_4831
LTSKMLEEALSSFEAVQAQLQQLDPQMIEIAGRLRRQPPQVAMTVARGSSDHAASYFAYLTMQLLGIPVASLPMSVVTMQQAPLKVSGQVAFAFSQSGQSPDLVNSLRLLRKRGALSISLVNAEDSPLEAACEFSLPLCAGTESSVAATKSFIATLSASARLIGHWKEDTELLDACRALPEGLRDAAQQDWSQAIDALRDCQRLMVIGRGAGFAIAQEAALKFKETSAIQAEAFSSAEVRHGPMALIGDNYPLLVFAPRGAEQAGLLSLAADMRQRGALVLLAAPDDVLERDLTLTRAEHPALDPILAIQSFYVMAAGLAVARGMDPDQPRHLSKVTRTH
Hit FamilyFIG00137522
Hit Family FunctionGlucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)


back to search