Query Sequence
>PfGW456L13_483
MSIEVRNVSKNFHAFKALDNISLDIQSGELVALLGPSGCGKTTLLRIIAGLETPDQGNIVFHGEDVSGHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPKNQRPSESQIATKVHELLNMVQLDWLSDRYPEQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRKELRRWLARLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPGDVYENPASDFVYHFLGDSNRLHLGEDRHVLFRPHEVSLSRHELEDHHAAEVRDIRPLGATTRVTLKVEGQSDLIEAEVVKDHDSLIGLAKGETLFFKPKVWQKLANI
Hit FamilyFIG00000959
Hit Family FunctionSulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)


back to search