Query Sequence
>PfGW456L13_4820
MTRIGTPLSPTATRVLMCGCGELGKEVVIELQRLGVEVIAVDRYANAPAMQVAHRSHVINMLDGAALRSVIEAEKPHFIVPEIEAIATATLVELEAEGFTVIPTARAAQLTMNREGIRRLAAEELDLPTSPYHFADTFEDYSKAVEDLGFPCVVKPVMSSSGKGQSLLRSVDDVQKAWDYAQEGGRAGKGRVIIEGFIDFDYEITLLTVRHVGGTTFCAPVGHRQEKGDYQESWQPQAMSPVALAESERVAKAVTEALGGRGLFGVELFIKGDQVWFSEVSPRPHDTGLVTLISQDLSQFALHARAILGLPIPLIRQFGPSASAVILVEGQSTQTAFANLGAALSEPDTALRLFGKPEVNGQRRMGVALARDESIEAARAKATRASQAVVVEL
Hit FamilyFIG00000909
Hit Family FunctionPhosphoribosylglycinamide formyltransferase 2 (EC 2.1.2.-)


back to search