Query Sequence
>PfGW456L13_4584
VDEKQRYDEGMKVRRAVLGDAHVDRSLTTLTEFNSEFQEMITRHAWGDIWTREGLPRHTRSLITIAMLIGMNREGELKLHLRAAANNGVSRGEIKEVIMQSAIYCGIPAANATFHLAESVWDELGVESRE
Hit FamilyFIG01304850
Hit Family Function4-carboxymuconolactone decarboxylase (EC 4.1.1.44)


back to search