Query Sequence
>PfGW456L13_4291
MADEILRQGELKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIAGFIAFLIMRQLGEMIVEEPVAGSFSHFAHKYWGGYAGFLSGWNYWVLYVLVGMAELTAVGKYVQFWWPEVPSWVSAAVFFVLVNLINMMNVKVFGEMEFWFAIIKVVAIIGMIALGCYMLFSGTGGPQASVSNLWDHGGFFPNGYSGLLMAMAFIMFSFGGLELVGITAAEASEPGKVIPKAINQVVYRVLIFYVGALTVLLSLYPWDQLLQTLGASGDAYGGSPFVQIFSLIGSDTAAHILNFVVLTAALSVYNSGVYCNSRMLYGLAEQGDAPKALMKLNKQGVPLLALGVSALITLLSVLVNYLAPHEALELLFALVVASLMINWAMISLTHLKFRKIMSQQGIVPGFKSFWFPFSNYLCLAFMVMIVCVMLMIPGIRASVFAIPVWVLIIFGFYRMRMAKDRALPVVQ
Hit FamilyFIG00116138
Hit Family FunctionAromatic amino acid transport protein AroP


back to search