Query Sequence
>PfGW456L13_397
MTTLNSTPRADGFYMPAEWAPQTQTWMIWPERPDNWRLGGKPAQAAHVAVAKAIARFEPVTVAVSAGQYENARARLDVPNIRVVEMSSDDAWVRDSGPTFVINNSGEVRGVNWDFNAWGGFDGGLYSPWNRDSQVGGKILEIERSPRYRTEGFVLEGGSIHVDGEGTLITTEECLLNRNRNPHMNRAEIEAVLSANLAVDKIIWLPDGLFNDETDGHVDNFCCYVRPGEVLLAWTDDPQDPNYPRCQAAMKALQSSTDAKGRPFTVHKMPIPGPLFATEEECAGVDPVDGTQERNPTVRLAGSYVNFLIVNGGIIAPSFDDPQDGPAKEILQNLFPQHEVVMVPGRELLLGGGNIHCLTQQQPAPHKE
Hit FamilyFIG00001062
Hit Family FunctionAgmatine deiminase (EC 3.5.3.12)


back to search