Query Sequence
>PfGW456L13_3945
MSKQILILPGDGIGPEIMAEAVKVLELASDKFALGFELSHDVIGGAAIDKHGVPLADETLERARAADAVLLGAVGGPKWDAIERDIRPERGLLKIRAQLGLFGNLRPAILYPQLAEASSLKPEIVAGLDILIVRELTGGIYFGAPRGTRTLENGERQSYDTLPYSESEIRRIARVGFDMAMVRGKKLCSVDKANVLASSQLWREVVEQVAKDYPEVELSHMYVDNAAMQLVRAPKQFDVIVTDNMFGDILSDQASMLTGSIGMLPSASLDTNNKGMYEPCHGSAPDIAGKGIANPLATILSVSMMLRYSFNQQAAADAIEKAVSLVLDQGLRTGDIWSAGCTKVGTQEMGDAVVAALRNL
Hit FamilyFIG00000341
Hit Family Function3-isopropylmalate dehydrogenase (EC 1.1.1.85)


back to search