Query Sequence
>PfGW456L13_3873
MNLQNIGVIGAGTMGNGIAQVCAMAGFNVTLLDISESALQKAVATVGKNLDRQIAKETLTPEQKQAALDKIRTSTDYSSLQNAQLVIEAATENLDLKLRVLQQIAAQVSSECVIASNTSSLSITQLAASVSQPERFIGLHFFNPVPVMGLIEVIRGLQTSDATHQLALDMATTLGKTAITAGNRPGFVVNRILVPMINEAILVFQEGLASAEDIDAGMRLGCNQPIGPLALADLIGLDTLLSILEAFYDGFNDSKYRPAPLLKEMVAAGYLGRKTGRGFHAYA
Hit FamilyFIG00068115
Hit Family Function3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)


back to search