Query Sequence
>PfGW456L13_3345
MNLSPLNRRRFELFKANKRGWWSLWLFLVLFGASLGAELIANDKPLVVHYDNNWYFPALKRYPETTFGGEFPLEANYKSPYIRELLKAKDAWVLWAPIPYSYQSINYDLKVPAPAPPSTDNLLGTDDQGRDVLARVIYGFRISVLFALTLTVLSSIIGVIAGALQGFYGGWVDLAGQRFLEIWSGLPVLYLLIILASFVQPNFWWLLGIMLLFSWMSLVDVVRAEFLRGRNLEYVRAARALGMQNGAIMFRHILPNAMVSTMTFMPFILTGAIGTLTALDFLGFGLPAGSPSLGELVAQGKSNLQAPWLGISAFAVLALMLSLLVFIGESARDAFDPRK
Hit FamilyFIG00455853
Hit Family FunctionOligopeptide transport system permease protein OppC (TC 3.A.1.5.1)


back to search