Query Sequence
>PfGW456L13_3318
MSQELRLIRRITLKLIPFLILLYLIAYVDRSAVGFAKLHMGADIGLGDAAYGLGAGLFFIGYFLLEIPSNLMLDRFGARRWFARIMVTWGAITIGMAFVQGPNSFYVMRFLLGAAEAGFFPGVLYYITQWFPVRHRGKILGLFILSQPIAMMITGPVSGGLLGMDGVLGLHGWQWLFIVIGAPAILLTWPVLRYLPDGPQQVKWMDQAEKDWLSGELKKDLDAYGQTRHGNPLHALKDKRVLLLALFYLPVTLSIYGLGLWLPTLIKQFGGSDLVTGFVSAVPYIFGIVGLLIIPRSSDRLNDRYGHLAVLYVLGAIGLFLSAWLSVPVLQLAALCLVAFALFSCTAVFWTLPGRFFAGASAAAGIALINSVGNLGGYLGPFVIGALKEYTGNLASGLYFLSGVMVFGLVLTGVVYRLLERKYVLPADQFAASARGASRT
Hit FamilyFIG00005529
Hit Family FunctionNitrate/nitrite transporter


back to search