Query Sequence
>PfGW456L13_3317
MRLVQFELSNGERRVGVVEAGLVREVQDTRTVRDLALAAIEASASLEQQVQSLGLGISHDYAELLTQRRILPPLDHADPAHMLVSGTGLTHLGSASARDKMHQQSGDETAMTDTMRIFKWGVEGGKPAVDEAGVQPEWFYKGDGGIVVRPGQPFPLPPFAEDAGEEPEIAGLYVIGHDGKPYRLGFAVGNEFSDHVMERKNYLYLAHSKLRSCSYGPELRVGELPQHLAGTSRILRDGEVLWQNEFLSGEANMCHSLANLEFHHFKYSQFLRPGDVHIHFFGTATLSFADGIRTQPGDVFEITQAEFGAPLINGIAPVAAAFEPGTVGTL
Hit FamilyFIG00882972
Hit Family FunctionSUGAR TRANSPORTER


back to search