Query Sequence
>PfGW456L13_321
MSQAEKIVITESQVSWQDVVAVARHGAQLELSAPIWARIENAQAIVQRIVTSGERAYGINTGLGALCNVSLQDEQLSQLSRNTLLSHACGVGVPLTDEQTRSIMCAAIVNYSHGKSGLHRQVVEALLALLNRGITPQVPSQGSVGYLTHMAHIGIALLGVGNVSYRGQIVSAQQALAEEGLQPVKLGAKDGLCLVNGTPCMSGLSCLAIADATRLLEWADVIGAMSFEAQRGQIDAFDAEIIALKPHPGMQQVGINLRALLDGSEVIAQSKGIRTQDALSIRSIPQVHGAARDQLVHAIKQIETELNGATDNPLVLGTADNYRVVSQANPHGQSVAMAADLLAIAMAEIGSIAERRLDRLINPHVSGLPAFLVANPGVNSGMMIVQYVAASLCAENRQLAQPAVLDNYVTSGLQEDHLSLGTNAALKLHRALENCTQILAIEYLLAAQAFEFLKEQRFGAGTDTAWRLLRERVPAYDQDRWLAPDIAAAASVLKDPVLLQKTLPNLN
Hit FamilyFIG00091940
Hit Family FunctionHistidine ammonia-lyase (EC 4.3.1.3)


back to search