Query Sequence
>PfGW456L13_2981
MQIQNKIFIVTGGASGLGAATAEVLVAAGAKVMLVDMNAEAVAAQAQRLGAQSVVADISNEAAAEAAVQATVKAFGGLNGLVNCAGIVRGEKILGKTGPHALASFSQVINVNLIGSFNMLRLAAAAIAETEADADGERGVIINTASAAAYDGQIGQAAYSASKGAIVSLTLPAARELARFGIRVMTIAPGIFETPMMAGMTQEVRDSLAAGVPFPPRLGKPSEYAGLVKHIIENSMLNGEVIRLDGALRMAAK
Hit FamilyFIG01304408
Hit Family FunctionProbable acyl-CoA dehydrogenase (EC 1.3.99.3)


back to search