Query Sequence
>PfGW456L13_2950
MSEIDILSFGETMAMFVAEQTGDLASVNEFHKRIAGADSNVAIGLSRLGFNVAWLSRVGADSLGRFVIDTLEKEGLDCRHVDIDPAHPTGFQLKSRTDDGSDPVVEYFRRGSAASHLSSHSIVPDLLKARHLHATGIPAALSETARQMSFELMTRMRDAGRSVSFDPNLRPSLWASERLMITEINRLAALAHWVLPGLSEGRLLTGFEDPADIAAFYLDQGAEAVAIKLGPHGAYYRTHLDQGFVAGVPVQTVVDTVGAGDGFAVGMISALLENHSFADAVRRANWIGSRAVQSRGDMEGLPTRSEMVSEFEAAIASKLAPTLDRIPM
Hit FamilyFIG00003699
Hit Family Function2-ketogluconate kinase (EC 2.7.1.13)


back to search