Query Sequence
>PfGW456L13_2740
MNSAKSITQWQEYIQGCLDFRPAEGIYRVARDMFTEPELFDLEMELIFEKNWIYACHESEIANPNDFLTMRAGRQPMIITRDGNNQLHALINACQHRGATLTRVSKGNQSTFTCPFHAWCYKSDGRLVKVKAPGEYPEGFDKATRGLKKARIESYKGFVFISLDVNGSDSLEDYLGDAKVFFDMMVAQSPTGELEILPGKSTYSYDGNWKLQHENGLDGYHVSTVHYNYVSTVQHRQQVNAANGGVSDTLDYSKLGAGDAETDDGWFSFKNGHSLLFSDMPNPTVRAGYATVMPRLIEEYGQQQAEWMMHRLRNLNIYPSLFFMDQISSQLRIVRPVAWNKTEITSQCIGVKGESDADRENRIRQFEDFFNVSGMGTPDDLVEFREAQRGFQARLERWNEVSRGSEKWVEGPTPNSEVLGINPVLTGTEFTHEGLYINQHGSWQRFLLQGLEQKALKLKEV
Hit FamilyFIG00138459
Hit Family FunctionBenzoate 1,2-dioxygenase alpha subunit (EC 1.14.12.10)


back to search