Query Sequence
>PfGW456L13_2689
MSNNGYESGRLNLPFVGHCTFGKSPVCTDWDALDADVAVLGVPNDMGTQWRSGARFGPRGIREASTLFSFGHAGAYDHEDDVMYLTASDVRMVDVGDADIVHTDMATSNKNTEYAVRKILDAGVMPVVLGGDHSVHAPVIKAFEGRGPIHIIHFDAHLDFVDERHGVRYGHGNPLRRASEMNHIVGMTQMGIRNVSSSNRDDYEAAHEAGSKILSVRDVRRLGVEGVLALIPQNINYYITIDIDGFDPSIAPGTGTPSHGGFLYYEVLEIIQALAKRSKGNIVGMDLVEVAPVYDPTGMTSILAAQLLLNSIGFIFHERGKVRAAAESETASA
Hit FamilyFIG00052802
Hit Family FunctionAgmatinase (EC 3.5.3.11)


back to search