Query Sequence
>PfGW456L13_2643
MGYKKIQVPAVGDKITVNADHSLNVPNNPIIPFIEGDGIGVDISPVMIKVVDAAVKKAYGGERKISWMEVYAGEKATQVYDQDTWLPQETLDAVKDYVVSIKGPLTTPVGGGIRSLNVALRQQLDLYVCLRPVRWFEGVPSPVKKPGDVDMTIFRENSEDIYAGIEWKAGTPEATKVIKFLKEEMGVTKIRFDENCGIGVKPVSLQGTKRLARKALQYVVDNDRDSLTIVHKGNIMKFTEGAFKEWAYEVAAEEFGATLLDGGPWMQFKNPKTGKNVIVKDAIADAMLQQILLRPAEYDVIATLNLNGDYLSDALAAEVGGIGIAPGANLSDTVAMFEATHGTAPKYAGKDQVNPGSLILSAEMMLRHMGWTEAADLIIKGTNGAISAKTVTYDFERLMEGAKLVSSSGFGDALISHM
Hit FamilyFIG00000600
Hit Family FunctionIsocitrate dehydrogenase [NADP] (EC 1.1.1.42)


back to search