Query Sequence
>PfGW456L13_2422
MTPQEIELIRQHPDFIQLVRRKQKLYWSLSLAMLVIYYGFVLLVAFSPSTLGQSLSGGVTTVGMLVGVVIVGLAFALTGFYVYRANNVIDPLNEKLKQECAR
Hit FamilyFIG00142956
Hit Family FunctionPutative membrane protein, clustering with ActP PaaL


back to search