Query Sequence
>PfGW456L13_2421
MNRLLALFLLPLAAVTDVAMAADGASRPLNWNAIGMFLVFVLFTLGVTRWAALRTRSTSDFYTAGGGMTGFQNGLAIAGDMISAASFLGISAMMFLNGYDGLLYALGVLAGWPIILFLIAERLRNLGKYTFADVVSYRLEQTPVRLTSAFGTLTVALMYLVAQMVGAGKLIELLFGIDYLYAVMLVGVLMVFYVTFGGMLATTWVQIIKAVMLLFGTSFMAFMVLKHFGFSTEAMFAGATAVHAKGNAIMAPGGLLSNPIDAISLGLGMMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYLLLIIVGFGAIVMVGTDPAFRDASGAIIGGGNMVAVHLAHAVGGNLFLGFISAVAFATILAVVAGLALSGASAVSHDLYACVMRKGQASEQQEMRVSRIATLCIGVLAIVLGLLFESQNIAFLSGLVLAIAASVNFPVLFLSMYWKGLTTRGAVLGSLSGLVSAIVLLVLSPAVWVNVMHHDKALFPYSNPALFSMSLAFFSAWLFSVTDTSPRAALERGRYLAQFIRSMTGIGATGASKH
Hit FamilyFIG01347644
Hit Family FunctionAcetate permease ActP (cation/acetate symporter)


back to search