Query Sequence
>PfGW456L13_2285
MNSLPVCQTLLLELHNGVLHITLNRPESRNAMSLQMVAELRSVLAAVRDKPGVRALVIGGVGGHFCAGGDIKDMANARAQGPTAHRDLNRVFGTLLQEVQHAPQVVITVLQGAVLGGGLGLACVSDIALSDHQAQFGLPETSLGLLPAQIVPFVVQRIGLTQTRRLALTAARFDGHQARRMGLVHFVEHDPQALAERLDEVLAHVLCCAPGANAATKKLLLASAGQPSDALLDQAAEWFSEAVTGAEGIEGTMAFVQKRKPGWAS
Hit FamilyFIG00137403
Hit Family FunctionIsohexenylglutaconyl-CoA hydratase


back to search