Query Sequence
>PfGW456L13_2136
MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVVVSVGPSTAQEQLRTALALGADRAILVESAEDLTSLAVAKLLKAVVDKEQPQLVILGKQAIDSDNNQTGQMLAALSGYGQGTFASKVEISGDSVAVTREIDGGAQTVSLKLPAIVTTDLRLNEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVEKLKNEAKVI
Hit FamilyFIG01304886
Hit Family FunctionElectron transfer flavoprotein, beta subunit


back to search