Query Sequence
>PfGW456L13_2127
MLKQALAQNGLIAILRGLRPQEAAAIGEVLYAAGFRVIEVPLNSPEPYESIRILRSTLPADCLIGAGTVLTPEQVEQVKAAGGQVIVMPHSDPKVLRAAKAAGLYLSPGVATPTEAFTALAEGADVLKLFPAEQMGPAVVKAWLAVLPAGTLLAPVGGITPDNMQSFIDAGVKGFGLGSGLFKPGMTPTQVAANAEAYVAAWKALR
Hit FamilyFIG00065872
Hit Family Function2-dehydro-3-deoxyphosphogalactonate aldolase (EC 4.1.2.21)


back to search