Query Sequence
>PfGW456L13_1975
MKSYEVNFDGLVGPTHNYGGLSYGNVASQSNSQQSSNPKEAALQGLAKMKALMEMGFQQGVLAPQERPDVAALRRLGFGGTDAQVIERAAKEAMPLLVASCSASSMWVANAATVSPSADTADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFADQKHFAHHAALPAVAQFGDEGAANHTRFCREYGEAGVEFFVFGRSAFDTRYPAPQKYPARQTLEASQAVARLHGLSDDGVVYAQQNPSVIDQGVFHNDVIAVGNGEVLFYHEDAFLETEKMLAELQSKLAKVGGKFQSVCVPRSAVSVEDAVRSYLFNSQLLSRPDGSMLLIVPEECRGNERVWQYLQGLTSSGGLIREVKVFDLKQSMQNGGGPACLRLRVALNETELAAVNPGVIMTAPLYGTLTEWVEKHYRDRMTENDLADPQLLLECRTALDELTQILKLGAVYPFQIN
Hit FamilyFIG00003226
Hit Family FunctionSuccinylarginine dihydrolase (EC 3.5.3.23)


back to search