Query Sequence
>PfGW456L13_1568
MHALPIANTLERRRAFQSFLGVSPALIAIGLFLIVPILIVIGYSLMEANPYGGVNKVFSSDAYTSLLFERQLDDSLAFADSYLIIALRSIGIAGLTTLITLLIGFPVAVWLAMQPAHRRGLLIFLITVPFWANLLIRTYAWILLLRNTGVINNSLMGLGVIDQPLQLLYTDGAVLLGVVYTYAPFVVLPIYATLEKMDIRLLEAAQDLYAGRVRTLRKVVLPIAKPGILAGAILTFVPCLGAMIAPELLGGGTRMMLGNLIFRQFSDARNWPFGAALSLVLMAAVMLVLTVYALRAERQRIAKGGA
Hit FamilyFIG00004037
Hit Family FunctionSpermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)


back to search