Query Sequence
>PfGW456L13_1233
MVKVGIVGGTGYTGVELLRLLAQHPQAEVVVITSRSEAGLAVADMYPNLRGHYDGLAFSVPDIKTLGACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRLQDADEWAKWYGQPHGAPELLDEAVYGLPEVNREQIKKARLIAVPGCYPTATQLGFLPLLEAGLADAAHLIADCKSGVSGAGRGASVGSLYSETSESMKAYAVKGHRHLPEIRQGLRRAAGKDVGLTFVPHLTPMIRGIHSTLYATVVDRSVDLQALFEKRYANEPFVDVMPAGSHPETRSVRGANVCRIAVHRPQDGDLVVVLSVIDNLVKGASGQAVQNMNILFGLDERLGLSHAGMLP
Hit FamilyFIG00000358
Hit Family FunctionN-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)


back to search