Query Sequence
>PfGW456L13_1171
MNKNNRHPADGKKPVTIFGPDFPFAFDDWIEHPAGLGSIPEHNHGAEVAIVGGGIAGLVAAYELMKLGLKPVVYEASKMGGRLRSQAFNGAEGIVAELGGMRFPVSSTAFYHYVDKLGLETKPFPNPLTPASGSTVIDLEGQTHYAQKLSDLPALFQEVADAWADALEAGSQFSDIQQAIRDRDVPRLKELWNTLVPLWDDRTFYDFVATSKAFAKLSFHHREVFGQVGFGTGGWDSDFPNSMLEIFRVVMTNCDDHQHLVVGGVEQVPQGIWRHVPERCAHWPAGTSLSSLHNGAPRTGVKKIAHAPGGRFAVTDNWGDTREYAAVLTTCQSWLLTTQIECDETLFSQKMWMALDRTRYMQSSKTFVMVDRPFWKDKDPETGRDLMSMTLTDRLTRGTYLFDNGDDKPGVICLSYSWMSDALKMLPQPVEKRVKLALDALKKIYPKVDIAARIIGDPITVSWEADPHFLGAFKGALPGHYRYNQRMYAHFMQDDMPAEQRGIFIAGDDVSWTPAWVEGAVQTSLNAVWGIMKHFGGATHAENPGPGDVFNEIGPIALPE
Hit FamilyFIG00049913
Hit Family FunctionLysine 2-monooxygenase (EC 1.13.12.2)


back to search